PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013612835.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 481aa    MW: 54175.4 Da    PI: 6.4478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013612835.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.4e-123175348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W+++Ed++l + +++ G+ +W+ Ia+++   ++  qc+ rw++yl
   XP_013612835.1 31 TWSQQEDDILRQQITLNGTQNWAIIASKFT-DKSTRQCRRRWYTYL 75
                     6****************************9.*************97 PP

2Myb_DNA-binding46.21.1e-1481124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg WT+eEd ll +a +++G++ W+ Ia+ +  gRt++ +k+r+ +
   XP_013612835.1  81 RGGWTPEEDTLLCEAQRLFGNR-WTEIAKVVS-GRTDNAVKNRFTT 124
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.5E-92172IPR009057Homeodomain-like
PROSITE profilePS5129413.2792475IPR017930Myb domain
SMARTSM007174.6E-112877IPR001005SANT/Myb domain
CDDcd001674.87E-103175No hitNo description
Gene3DG3DSA:1.10.10.604.7E-183283IPR009057Homeodomain-like
PfamPF139217.3E-143292No hitNo description
SuperFamilySSF466891.21E-2455134IPR009057Homeodomain-like
PROSITE profilePS5129421.25476130IPR017930Myb domain
SMARTSM007174.0E-1580128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-1984129IPR009057Homeodomain-like
CDDcd001673.24E-1184125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MEETTKKTTK KNKFVINEED DSKKKERHFV TWSQQEDDIL RQQITLNGTQ NWAIIASKFT  60
DKSTRQCRRR WYTYLNSDFK RGGWTPEEDT LLCEAQRLFG NRWTEIAKVV SGRTDNAVKN  120
RFTTLCKKRA KYEAMAKENS IACSVNSNNK RVLFPDGVTT PCKVESESPI AKKTRRSHIP  180
NLKEISSYGD RSHIKVHSGV NQQVRPPFSV PPHNAASGDS TEEHQTGSVK DVEGKHKGNQ  240
EAFLKKDDPK VTNLMQQAEL LSSLAHKVNS DNTEQSMENA WKVLQNFLNK SKENDIFRYG  300
LPEMDFQLEE EFKDLVEDLR SSNEASQASY RQPDLHDSPA SSENSSGSTV MPHLSGDKTQ  360
QQPMSDTQTI SQKQSVVEVL QDQGIVSDAT VEQEGLLSTC HDDILKNCSE IVPMSGEEEF  420
NSPVQVTPLF RSLAAGIPSP QFSESERSFL LKTLGVESPY PCPSANPSQP PPCKRVLLDS  480
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A6e-25331566116MYB3
3zqc_D6e-25331566116MYB3
3zqc_G6e-25331566116MYB3
3zqc_J6e-25331566116MYB3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612835.10.0PREDICTED: myb-related protein 3R-1
TrEMBLA0A0D3AVK70.0A0A0D3AVK7_BRAOL; Uncharacterized protein
STRINGBra026578.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88